wholesale IGF 0.1mg/vial -ES

  • Model: 0.1mg
  • 56 Units in Stock
$110.00
Qty :
+
-

Lyophilized powder form,lables removed before ship
Not avaliable for Australia
Comprar 1kits/0.1mg * 10vial, poder congelado, como la insulina-factores de crecimiento

 liofilizar
Al igual que la insulina humana recombinante del factor de crecimiento-1 R3 largo
IGF1 R3 a largo
Número de catálogo CYT-022
Sinónimos R3 IGF-1, R3 IGF-1, R3IGF1, R3IGF-1, IGF-1 LARGO, LARGO IGF-1, A LARGO R3 IGF-1, A LARGO R3IGF1, largo R3 IGF-1, A LARGO R3IGF-1.
Introducción IGF-1 (Insulin-like Growth Factor-1) es un importante mediador hormonal de crecimiento en estatura. Bajo circunstancias normales, la GH (hormona del crecimiento) se une a su receptor en el hígado y otros tejidos, y estimula la síntesis / secreción de IGF-1. En los tejidos blanco, el tipo 1 del receptor de IGF, que es homóloga al receptor de insulina, es activada por IGF-1, que conduce a la señalización intracelular que estimula múltiples procesos de crecimiento en estatura. IGF-1 las acciones metabólicas son en parte dirigidas a estimular la captación de glucosa, ácidos grasos y aminoácidos por lo que el metabolismo de los tejidos en crecimiento apoya.
La descripción de la LR3 es un análogo de largo plazo de la IGF-1 humano, diseñado y fabricado específicamente para el cultivo de células de mamíferos para apoyar a gran escala de fabricación de productos biofarmacéuticos recombinantes.
Insulina humana recombinante a largo R3 factor de crecimiento-1 producida en E. coli es una sola, no glicosilada, la cadena de polipéptido que contiene 83 aminoácidos con una masa molecular de 9.1kDa.
Fuente Escherichia Coli.
Apariencia física filtrado estéril liofilizado blanco (liofilizado) en polvo.
Formulación liofilizada de un 0.2μm solución filtrada se concentró en 1XPBS.
Solubilidad Se recomienda para reconstituir el liofilizado IGF1 largo R3 en 18 millones de estériles? Cm de H2O no menos de 100μg/ml, que puede diluirse con otras soluciones acuosas.
Estabilidad liofilizado IGF1 R3 largo, aunque estable a temperatura ambiente durante 3 semanas, se debe almacenar desecado por debajo de -18 ° C. Tras la reconstitución, el IGF1 R3 largo debe ser almacenada a 4 ° C entre 2-7 días y para su uso futuro por debajo de -18 ° C.
Para el almacenamiento a largo plazo se recomienda añadir una proteína transportadora (0,1% HSA o BSA).
Por favor, evitar los ciclos de congelación-descongelación.
Pureza superior al 95,0%, determinado por SDS-PAGE.
Secuencia de aminoácidos MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.
Actividad biológica de la ED50 según lo determinado por la estimulación de la síntesis de proteínas en los mioblastos L6 es inferior a 10 ng / ml, que corresponde a una actividad específica de 100.000 unidades / mg
 


Qty Discounts New Price
1
$110.00
2
$105.00
3
$100.00
4-9
$96.00
10-14
$94.00
15+
$92.00
 

Current Reviews: 81